Structure of PDB 1lkk Chain A Binding Site BS01

Receptor Information
>1lkk Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFD
QNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLS
RPCQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lkk Crystal structures of the human p56lck SH2 domain in complex with two short phosphotyrosyl peptides at 1.0 A and 1.8 A resolution.
Resolution1.0 Å
Binding residue
(original residue number in PDB)		R134 R154 S156 E157 S158 S164 H180 Y181 K182 R196 G215
Binding residue
(residue number reindexed from 1)		R13 R33 S35 E36 S37 S43 H59 Y60 K61 R75 G94
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1lkk, PDBe:1lkk, PDBj:1lkk
PDBsum1lkk
PubMed8604142
UniProtP06239|LCK_HUMAN Tyrosine-protein kinase Lck (Gene Name=LCK)

[Back to BioLiP]