Structure of PDB 1le8 Chain A Binding Site BS01

Receptor Information

>1le8 Chain A (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
RSK

Ligand information

>1le8 Chain C (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acatgtaaaaatttacatca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1le8 Structural and Thermodynamic Characterization of the DNA Binding Properties of a Triple Alanine Mutant of MATalpha2
Resolution	2.3 Å
Binding residue (original residue number in PDB)	K100 R115 I119 R122 M123
Binding residue (residue number reindexed from 1)	K27 R42 I46 R49 M50
Binding affinity	PDBbind-CN: Kd=4.51uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1le8, PDBe:1le8, PDBj:1le8
PDBsum	1le8
PubMed	12121651
UniProt	P0CY10\|MATA1_YEASX Mating-type protein A1 (Gene Name=MATA1)

[Back to BioLiP]