Structure of PDB 1le5 Chain A Binding Site BS01

Receptor Information

>1le5 Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYT
GPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLG
IQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRD
PAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCD
KVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVR
VSMQLRRPSDRELSEPMEFQYLPD

Ligand information

>1le5 Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgggaaattcct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1le5 The X-ray crystal structure of the NF-kB p50/p65 heterodimer bound to the Interferon beta-kB site
Resolution	2.75 Å
Binding residue (original residue number in PDB)	R35 Y36 C38 E39 K122 R187 P189 K221 R246 Q247
Binding residue (residue number reindexed from 1)	R18 Y19 C21 E22 K105 R170 P172 K204 R229 Q230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1le5, PDBe:1le5, PDBj:1le5
PDBsum	1le5
PubMed	11970948
UniProt	Q04207\|TF65_MOUSE Transcription factor p65 (Gene Name=Rela)

[Back to BioLiP]