Structure of PDB 1lcj Chain A Binding Site BS01

Receptor Information
>1lcj Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQ
NQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSR
PCQT
Ligand information
>1lcj Chain B (length=11) Species: 1891729 (Alphapolyomavirus mauratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPQYEEIPIYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lcj Recognition of a high-affinity phosphotyrosyl peptide by the Src homology-2 domain of p56lck.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R134 R154 S156 E157 S158 S164 H180 Y181 K182 R196 G215
Binding residue
(residue number reindexed from 1)
R12 R32 S34 E35 S36 S42 H58 Y59 K60 R74 G93
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1lcj, PDBe:1lcj, PDBj:1lcj
PDBsum1lcj
PubMed7680435
UniProtP06239|LCK_HUMAN Tyrosine-protein kinase Lck (Gene Name=LCK)

[Back to BioLiP]