Structure of PDB 1lb5 Chain A Binding Site BS01

Receptor Information
>1lb5 Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQ
LPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNH
EEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVR
CEVST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lb5 Distinct molecular mechanism for initiating TRAF6 signalling.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R392 F410 M450 A458 P468 K469 G470 F471 G472 Y473
Binding residue
(residue number reindexed from 1)		R46 F64 M104 A112 P122 K123 G124 F125 G126 Y127
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0016567 protein ubiquitination
GO:0043122 regulation of canonical NF-kappaB signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lb5, PDBe:1lb5, PDBj:1lb5
PDBsum1lb5
PubMed12140561
UniProtQ9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 (Gene Name=TRAF6)

[Back to BioLiP]