Structure of PDB 1l9a Chain A Binding Site BS01

Receptor Information

>1l9a Chain A (length=87) Species: 2190 (Methanocaldococcus jannaschii)

MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRD
KRYPRQHWEIAGRVEVDYKGNKLCLLKEIAKIIKGKN

Ligand information

>1l9a Chain B (length=126)

gacacuaaguucggcaucaauauggugaccucccgggagcgggggaccac
cagguugccuagaggggugaaccggcccaggucggaaacggagcagguca
aaacucccgugcugaucaguaguguc

<<<<<<..<.<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>
>>.>>>>......<<<<<.....<<<<..<.<<<....>>>..>.>>>>.
..>>>>>.>>>>>>>.>...>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1l9a Crystal structure of SRP19 in complex with the S domain of SRP RNA and its implication for the assembly of the signal recognition particle.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): M1 I2 W4 Y7 S13 R14 R15 R18 K19 P21 E22 K51 R52 P54 R55 H57 R63 N71 K72 K77
• Binding residue (residue number reindexed from 1): M1 I2 W4 Y7 S13 R14 R15 R18 K19 P21 E22 K51 R52 P54 R55 H57 R63 N71 K72 K77

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0008312 7S RNA binding

Biological Process

• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0048500 signal recognition particle

External links

• PDB: RCSB:1l9a, PDBe:1l9a, PDBj:1l9a
• PDBsum: 1l9a
• PubMed: 12086622
• UniProt: Q58440|SRP19_METJA Signal recognition particle 19 kDa protein (Gene Name=srp19)