Structure of PDB 1l4a Chain A Binding Site BS01

Receptor Information
>1l4a Chain A (length=66) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAG
ASQFEASAGKLKRKFW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l4a X-ray structure of a neuronal complexin-SNARE complex from squid.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		R56 D66 S67 S70
Binding residue
(residue number reindexed from 1)		R24 D34 S35 S38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1l4a, PDBe:1l4a, PDBj:1l4a
PDBsum1l4a
PubMed12004067
UniProtP47194|SYB_DORPE Synaptobrevin

[Back to BioLiP]