Structure of PDB 1l2z Chain A Binding Site BS01

Receptor Information
>1l2z Chain A (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQF
YNSKRIDFDLYT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l2z Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules
ResolutionN/A
Binding residue
(original residue number in PDB)		Y6 W8 Y17 F20 W28 E31 Y33
Binding residue
(residue number reindexed from 1)		Y6 W8 Y17 F20 W28 E31 Y33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:1l2z, PDBe:1l2z, PDBj:1l2z
PDBsum1l2z
PubMed12426371
UniProtO95400|CD2B2_HUMAN CD2 antigen cytoplasmic tail-binding protein 2 (Gene Name=CD2BP2)

[Back to BioLiP]