Structure of PDB 1l1c Chain A Binding Site BS01

Receptor Information
>1l1c Chain A (length=55) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTL
DNKDV
Ligand information
>1l1c Chain C (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggauuguuacugcuacggcaggcaaaacc
<<.<<<<..<<<<....>>>>>>>>..>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l1c Solution structure of the LicT-RNA antitermination complex: CAT clamping RAT.
ResolutionN/A
Binding residue
(original residue number in PDB)		V6 N9 N10 M25 G26 R27 F31 Q32
Binding residue
(residue number reindexed from 1)		V6 N9 N10 M25 G26 R27 F31 Q32
Binding affinityPDBbind-CN: Kd=10nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1l1c, PDBe:1l1c, PDBj:1l1c
PDBsum1l1c
PubMed11953318
UniProtP39805|LICT_BACSU Transcription antiterminator LicT (Gene Name=licT)

[Back to BioLiP]