Structure of PDB 1l0i Chain A Binding Site BS01

Receptor Information

>1l0i Chain A (length=77) Species: 562 (Escherichia coli)

STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEF
DTEIPDEEAEKMTTVQAAIDYINGHQA

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1l0i Chain A Residue 1008

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1l0i X-ray Crystallographic Studies on Butyryl-ACP Reveal Flexibility of the Structure around a Putative Acyl Chain Binding Site
• Resolution: 1.2 Å
• Binding residue (original residue number in PDB): E47 E53
• Binding residue (residue number reindexed from 1): E47 E53
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): D35
• Catalytic site (residue number reindexed from 1): D35

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0031177 phosphopantetheine binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process
• GO:0009410 response to xenobiotic stimulus

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1l0i, PDBe:1l0i, PDBj:1l0i
• PDBsum: 1l0i
• PubMed: 12057197
• UniProt: P0A6A8|ACP_ECOLI Acyl carrier protein (Gene Name=acpP)