Structure of PDB 1l0a Chain A Binding Site BS01

Receptor Information
>1l0a Chain A (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYK
RRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTG
EMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l0a Downstream regulator TANK binds to the CD40 recognition site on TRAF3.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V344 W356 K357 R364 G371 K372 T373 L374 S375 Y377 S378 Q379 Y395 D399 G400 F410 A447 F448 S456 F457 I466 A467 S468 G469 P471
Binding residue
(residue number reindexed from 1)		V32 W44 K45 R52 G59 K60 T61 L62 S63 Y65 S66 Q67 Y83 D87 G88 F98 A135 F136 S144 F145 I154 A155 S156 G157 P159
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0001817 regulation of cytokine production
GO:0008063 Toll signaling pathway
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0045087 innate immune response
GO:0050688 regulation of defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1l0a, PDBe:1l0a, PDBj:1l0a
PDBsum1l0a
PubMed12005438
UniProtQ13114|TRAF3_HUMAN TNF receptor-associated factor 3 (Gene Name=TRAF3)

[Back to BioLiP]