Structure of PDB 1kuq Chain A Binding Site BS01

Receptor Information
>1kuq Chain A (length=84) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSH
RGLLMMVGQRRRLLRYLQREDPERYRALIEKLGI
Ligand information
>1kuq Chain B (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcggccuucgggcuagacggugggagaggcuucggcugguccacccgu
gacgcuc
<<<<.<<<....>>>...<<<<<<<<...<<<<..>>>>..>>>>>.>>>
...>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kuq Role of N-terminal helix in interaction of ribosomal protein S15 with 16S rRNA.
Resolution2.84 Å
Binding residue
(original residue number in PDB)		K7 Q8 F17 T21 G22 S23 Q27 L30 L38 H41 V44 H45 K47 D48 H50 S51 G54 R64 Y68
Binding residue
(residue number reindexed from 1)		K5 Q6 F15 T19 G20 S21 Q25 L28 L36 H39 V42 H43 K45 D46 H48 S49 G52 R62 Y66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kuq, PDBe:1kuq, PDBj:1kuq
PDBsum1kuq
PubMed15627386
UniProtP80378|RS15_THETH Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]