Structure of PDB 1kui Chain A Binding Site BS01

Receptor Information
>1kui Chain A (length=201) Species: 103944 (Protobothrops mucrosquamatus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRFPQRYIELAIVVDHGMYTKYSSNFKKIRKRVHQMVSNINEMCRPLNIA
ITLALLDVWSEKDFITVQADAPTTAGLFGDWRERVLLKKKNHDHAQLLTD
TNFARNTIGWAYVGRMCDEKYSVAVVKDHSSKVFMVAVTMTHELGHNLGM
EHDDKDKCKCDTCIMSAVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNA
P
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kui Determinants of the inhibition of a Taiwan habu venom metalloproteinase by its endogenous inhibitors revealed by X-ray crystallography and synthetic inhibitor analogues.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		R107 N108 T109 I110 T141 H144 E145 I166 S168 A169 V170 I171
Binding residue
(residue number reindexed from 1)		R105 N106 T107 I108 T139 H142 E143 I164 S166 A167 V168 I169
Enzymatic activity
Enzyme Commision number 3.4.24.-
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kui, PDBe:1kui, PDBj:1kui
PDBsum1kui
PubMed12071970
UniProtO57413|VM2T3_PROMU Zinc metalloproteinase/disintegrin

[Back to BioLiP]