Structure of PDB 1kqq Chain A Binding Site BS01

Receptor Information
>1kqq Chain A (length=131) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKS
VLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAALTLRTQY
MKYLYPYECEKKNLSTPAELQAAIDGNRREG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kqq The structure of the Dead ringer-DNA complex reveals how AT-rich interaction domains (ARIDs) recognize DNA.
ResolutionN/A
Binding residue
(original residue number in PDB)		I48 M49 S90 T92
Binding residue
(residue number reindexed from 1)		I46 M47 S88 T90
Binding affinityPDBbind-CN: Kd=28nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kqq, PDBe:1kqq, PDBj:1kqq
PDBsum1kqq
PubMed11867548
UniProtQ24573|DRI_DROME Protein dead ringer (Gene Name=retn)

[Back to BioLiP]