Structure of PDB 1kne Chain A Binding Site BS01

Receptor Information
>1kne Chain A (length=52) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEA
SR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kne Structure of HP1 chromodomain bound to a lysine 9-methylated histone H3 tail.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
E23 Y24 A25 V26 W45 Y48 E56 N60 D62 C63
Binding residue
(residue number reindexed from 1)
E1 Y2 A3 V4 W23 Y26 E34 N38 D40 C41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1kne, PDBe:1kne, PDBj:1kne
PDBsum1kne
PubMed11859155
UniProtP05205|HP1_DROME Heterochromatin protein 1 (Gene Name=Su(var)205)

[Back to BioLiP]