Structure of PDB 1kmc Chain A Binding Site BS01

Receptor Information
>1kmc Chain A (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF
DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV
TPIKDLTAHFRGDRCKTLLEKPKLFFIQAARGTELDDGIQRYKIPVEADF
LFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRV
ARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kmc Crystal Structure of the Caspase-7 / XIAP-BIR2 Complex
Resolution2.9 Å
Binding residue
(original residue number in PDB)		G175C M176 H237 T288 Y338 W340 R341 S342 P343 W348 S381A Q381B F381H
Binding residue
(residue number reindexed from 1)		G27 M28 H88 T133 Y161 W163 R164 S165 P166 W171 S206 Q207 F213
Enzymatic activity
Catalytic site (original residue number in PDB) G177 V178 H237 G238 A285
Catalytic site (residue number reindexed from 1) G29 V30 H88 G89 A130
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004190 aspartic-type endopeptidase activity
GO:0004197 cysteine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008234 cysteine-type peptidase activity
GO:0097153 cysteine-type endopeptidase activity involved in apoptotic process
GO:0097200 cysteine-type endopeptidase activity involved in execution phase of apoptosis
Biological Process
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0007507 heart development
GO:0009411 response to UV
GO:0016485 protein processing
GO:0030163 protein catabolic process
GO:0042742 defense response to bacterium
GO:0043525 positive regulation of neuron apoptotic process
GO:0044346 fibroblast apoptotic process
GO:0051146 striated muscle cell differentiation
GO:0051402 neuron apoptotic process
GO:0051604 protein maturation
GO:0070227 lymphocyte apoptotic process
GO:0071222 cellular response to lipopolysaccharide
GO:0071887 leukocyte apoptotic process
GO:0072734 cellular response to staurosporine
GO:0097194 execution phase of apoptosis
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kmc, PDBe:1kmc, PDBj:1kmc
PDBsum1kmc
PubMed
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]