Structure of PDB 1klq Chain A Binding Site BS01

Receptor Information
>1klq Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTD
LELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDK
TAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTD
KDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1klq The Mad2 spindle checkpoint protein undergoes similar major conformational changes upon binding to either Mad1 or Cdc20.
ResolutionN/A
Binding residue
(original residue number in PDB)		V70 W77 F153 D154 L155 L156 I157 Y158 T159 L163 V164 V165 K168 W169 E170 E171 S172 G173 P174 F176
Binding residue
(residue number reindexed from 1)		V60 W67 F143 D144 L145 L146 I147 Y148 T149 L153 V154 V155 K158 W159 E160 E161 S162 G163 P164 F166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000132 establishment of mitotic spindle orientation
GO:0007094 mitotic spindle assembly checkpoint signaling
GO:0042177 negative regulation of protein catabolic process
GO:0043066 negative regulation of apoptotic process
GO:0045930 negative regulation of mitotic cell cycle
GO:0051301 cell division
GO:0051660 establishment of centrosome localization
GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint
GO:1904667 negative regulation of ubiquitin protein ligase activity
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0033597 mitotic checkpoint complex
GO:0044615 nuclear pore nuclear basket
GO:0048471 perinuclear region of cytoplasm
GO:0072686 mitotic spindle
GO:1990728 mitotic spindle assembly checkpoint MAD1-MAD2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1klq, PDBe:1klq, PDBj:1klq
PDBsum1klq
PubMed11804586
UniProtQ13257|MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A (Gene Name=MAD2L1)

[Back to BioLiP]