Structure of PDB 1kl8 Chain A Binding Site BS01

Receptor Information
>1kl8 Chain A (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS
KKPYEEVTCCSTDKCNPHPKQRPG
Ligand information
>1kl8 Chain B (length=19) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IPGKRTESFYECCKEPYPD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kl8 NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor.
ResolutionN/A
Binding residue
(original residue number in PDB)		A7 S9 I11 W28 R36 G37 K38 V39 V40 E41 H68
Binding residue
(residue number reindexed from 1)		A7 S9 I11 W28 R36 G37 K38 V39 V40 E41 H68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kl8, PDBe:1kl8, PDBj:1kl8
PDBsum1kl8
PubMed11790782
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]