Structure of PDB 1kl5 Chain A Binding Site BS01

Receptor Information
>1kl5 Chain A (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITGTWYNQLGSTFIVTAGADGALTGTYIGARGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVKPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kl5 Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y54 W79 S88 T90 W108
Binding residue
(residue number reindexed from 1)		Y39 W64 S73 T75 W93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1kl5, PDBe:1kl5, PDBj:1kl5
PDBsum1kl5
PubMed11910031
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]