Structure of PDB 1kix Chain A Binding Site BS01

Receptor Information
>1kix Chain A (length=446) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEYVELAKASLTSAQPQHFYAVVIDATFPYKTNQERYICSLKIVDPTLYL
KQQKGAGDASDYATLVLYAKRFEDLPIIHRAGDIIRVHRATLRLYNGQRQ
FNANVFYSSSWALFSTDKRSVTQEINNQDTTPFSFSSKHATIEKNEISIL
QNLRKWANQYFSSYSVISSDMYTALNKAQAQKGDFDVVAKILQVHELDEY
TNELKLKDASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLI
LSHYSNIITFIQSSKLAKELRAKIQDDHSSLNAVVLTEVDKKHAALPSTS
LQDLFHHADSDKELQAQDTFRTQFYVTKIEPSDVKEWVKGYDRKTKKSSS
LKGASGKGDNIFQVQFLVKDASTQLNNNTYRVLLYTQDGLGANFFNVKAD
NLHKNADARKKLEDSAELLTKFNSYVDAVVERRNGFYLIKDTKLIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kix Dimeric structure of the Oxytricha nova telomere end-binding protein alpha-subunit bound to ssDNA.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
P51 Y65 T67 N68 R71 I73 S75 K77 Y103 R124 T126 R128 Y130 Q135 N137 N139 D223 D225 R274 S275 Y293
Binding residue
(residue number reindexed from 1)
P16 Y30 T32 N33 R36 I38 S40 K42 Y68 R89 T91 R93 Y95 Q100 N102 N104 D184 D186 R235 S236 Y254
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0010521 telomerase inhibitor activity
GO:0043047 single-stranded telomeric DNA binding
GO:0098505 G-rich strand telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0016233 telomere capping
GO:0032210 regulation of telomere maintenance via telomerase
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000782 telomere cap complex
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005694 chromosome
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1kix, PDBe:1kix, PDBj:1kix
PDBsum1kix
PubMed11836536
UniProtP29549|TEBA_STENO Telomere-binding protein subunit alpha (Gene Name=MAC-56A)

[Back to BioLiP]