Structure of PDB 1khq Chain A Binding Site BS01

Receptor Information
>1khq Chain A (length=212) Species: 3649 (Carica papaya) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSE
QELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREK
GPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFV
GPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVC
GLYTSSFYPVKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1khq Two polymorphs of a covalent complex between papain and a diazomethylketone inhibitor
Resolution1.6 Å
Binding residue
(original residue number in PDB)		G23 C25 G65 G66 Y67 V133 D158
Binding residue
(residue number reindexed from 1)		G23 C25 G65 G66 Y67 V133 D158
Enzymatic activity
Catalytic site (original residue number in PDB) V16 Q19 C25 N155 H159 N175
Catalytic site (residue number reindexed from 1) V16 Q19 C25 N155 H159 N175
Enzyme Commision number 3.4.22.2: papain.
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1khq, PDBe:1khq, PDBj:1khq
PDBsum1khq
PubMed15357669
UniProtP00784|PAPA1_CARPA Papain

[Back to BioLiP]