Structure of PDB 1kg0 Chain A Binding Site BS01

Receptor Information

>1kg0 Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFDA

Ligand information

>1kg0 Chain D (length=13) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1kg0 Structure of the Epstein-Barr virus gp42 protein bound to the MHC class II receptor HLA-DR1.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	Q9 E11 F51 S53 F54 G58 N62 V65 D66 N69
Binding residue (residue number reindexed from 1)	Q7 E9 F49 S51 F52 G56 N60 V63 D64 N67

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1kg0, PDBe:1kg0, PDBj:1kg0
PDBsum	1kg0
PubMed	11864610
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]