Structure of PDB 1kdx Chain A Binding Site BS01

Receptor Information
>1kdx Chain A (length=81) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKV
EGDMYESANSRDEYYHLLAEKIYKIQKELEE
Ligand information
>1kdx Chain B (length=28) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TDSQKRREILSRRPSYRKILNDLSSDAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kdx Solution structure of the KIX domain of CBP bound to the transactivation domain of CREB: a model for activator:coactivator interactions.
ResolutionN/A
Binding residue
(original residue number in PDB)		L599 H602 L603 K606 Y650 H651 A654 E655 Y658
Binding residue
(residue number reindexed from 1)		L14 H17 L18 K21 Y65 H66 A69 E70 Y73
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kdx, PDBe:1kdx, PDBj:1kdx
PDBsum1kdx
PubMed9413984
UniProtP45481|CBP_MOUSE Histone lysine acetyltransferase CREBBP (Gene Name=Crebbp)

[Back to BioLiP]