Structure of PDB 1kc2 Chain A Binding Site BS01

Receptor Information
>1kc2 Chain A (length=96) Species: 11886 (Rous sarcoma virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSLNVAH
YKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kc2 Dissection of the energetic coupling across the Src SH2 domain-tyrosyl phosphopeptide interface.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
R157 R177 E180 T181 H203 Y204 K205 R219 G238
Binding residue
(residue number reindexed from 1)
R11 R31 E34 T35 H50 Y51 K52 R66 G85
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1kc2, PDBe:1kc2, PDBj:1kc2
PDBsum1kc2
PubMed11851339
UniProtP00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]