Structure of PDB 1kbu Chain A Binding Site BS01

Receptor Information
>1kbu Chain A (length=324) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAE
PEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVM
RRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIA
YNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGV
TKLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEA
THRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTN
VNIVMNYIRNLDSETGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kbu The Order of Strand Exchanges in Cre-LoxP Recombination and its Basis Suggested by the Crystal Structure of a Cre-LoxP Holliday Junction Complex
Resolution2.2 Å
Binding residue
(original residue number in PDB)		M44 S47 R81 L83 A84 T87 A131 K132 Q156 R159 R173 K201 T202 R241 V242 R243 K244 L256 S257 R259 R282 Y283 W315 Y324
Binding residue
(residue number reindexed from 1)		M27 S30 R64 L66 A67 T70 A114 K115 Q139 R142 R156 K184 T185 R224 V225 R226 K227 L239 S240 R242 R265 Y266 W298 Y307
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kbu, PDBe:1kbu, PDBj:1kbu
PDBsum1kbu
PubMed12051940
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]