Structure of PDB 1ka7 Chain A Binding Site BS01

Receptor Information
>1ka7 Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGY
IYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQY
PVEKKSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ka7 A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
ResolutionN/A
Binding residue
(original residue number in PDB)		E17 Y50 I51 Y52 T53 Y54 E67 T68 V72 G93
Binding residue
(residue number reindexed from 1)		E17 Y50 I51 Y52 T53 Y54 E67 T68 V72 G93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
Biological Process
GO:0002250 adaptive immune response
GO:0006959 humoral immune response
GO:0006968 cellular defense response
GO:0007267 cell-cell signaling
GO:0030101 natural killer cell activation
GO:0042267 natural killer cell mediated cytotoxicity
GO:0045087 innate immune response
GO:0045954 positive regulation of natural killer cell mediated cytotoxicity
GO:0050776 regulation of immune response
GO:0050860 negative regulation of T cell receptor signaling pathway
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ka7, PDBe:1ka7, PDBj:1ka7
PDBsum1ka7
PubMed11823424
UniProtO60880|SH21A_HUMAN SH2 domain-containing protein 1A (Gene Name=SH2D1A)

[Back to BioLiP]