Structure of PDB 1k9q Chain A Binding Site BS01

Receptor Information
>1k9q Chain A (length=40) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k9q Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
ResolutionN/A
Binding residue
(original residue number in PDB)
Y28 L30 N31 H32 Q35 T36 T37 W39
Binding residue
(residue number reindexed from 1)
Y24 L26 N27 H28 Q31 T32 T33 W35
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1k9q, PDBe:1k9q, PDBj:1k9q
PDBsum1k9q
PubMed11743730
UniProtP46937|YAP1_HUMAN Transcriptional coactivator YAP1 (Gene Name=YAP1)

[Back to BioLiP]