Structure of PDB 1k8g Chain A Binding Site BS01

Receptor Information

>1k8g Chain A (length=269) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YEYVELAKASLTSAQPQHFYAVVIDATFPYKTYICSLKIVDPTLYLKQSD
YATLVLYAKRFEDLPIIHRAGDIIRVHRATLRLYNGQRQFNANVFYSSSW
ALFSTDKRSVTQEINNQDAVSDTTPFSFSSKHATIEKNEISILQNLRKWA
NQYFSSYSVISSDMYTALNKAQAQKGDFDVVAKILQVHELDEYTNELKLK
DASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLILSHYSNI
ITFIQSSKLAKELRAKIQD

Ligand information

>1k8g Chain D (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1k8g Crystal structure of the N-terminal domain of Oxytricha nova telomere end-binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Y65 I73 S75 K77 Y103 R128 Y130 Q135 D223 D225 R274 S275 Y293
Binding residue (residue number reindexed from 1)	Y30 I34 S36 K38 Y57 R82 Y84 Q89 D177 D179 R228 S229 Y247

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043047	single-stranded telomeric DNA binding

	Biological Process
GO:0000723	telomere maintenance

	Cellular Component
GO:0000781	chromosome, telomeric region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1k8g, PDBe:1k8g, PDBj:1k8g
PDBsum	1k8g
PubMed	11743727
UniProt	P29549\|TEBA_STENO Telomere-binding protein subunit alpha (Gene Name=MAC-56A)

[Back to BioLiP]