Structure of PDB 1k82 Chain A Binding Site BS01

Receptor Information
>1k82 Chain A (length=260) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLS
VQRRAKYLLLELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGK
VLRYTDPRRFGAWLWTKELEGHNVLTHLGPEPLSDDFNGEYLHQKCAKKK
TAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARV
IKAVLLRSIEQGGTTLKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQR
ATFYCRQCQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k82 Structure of formamidopyrimidine-DNA glycosylase covalently complexed to DNA.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K88 H89 P107 R108 R109 F110 K149 T151 P155 W156 A256 Q257
Binding residue
(residue number reindexed from 1)		K88 H89 P107 R108 R109 F110 K149 T151 P155 W156 A248 Q249
Enzymatic activity
Catalytic site (original residue number in PDB) P1 E2
Catalytic site (residue number reindexed from 1) P1 E2
Enzyme Commision number 3.2.2.23: DNA-formamidopyrimidine glycosylase.
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0000703 oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004519 endonuclease activity
GO:0008270 zinc ion binding
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016787 hydrolase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0019104 DNA N-glycosylase activity
GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0046872 metal ion binding
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006974 DNA damage response
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1k82, PDBe:1k82, PDBj:1k82
PDBsum1k82
PubMed11912217
UniProtP05523|FPG_ECOLI Formamidopyrimidine-DNA glycosylase (Gene Name=mutM)

[Back to BioLiP]