Structure of PDB 1k79 Chain A Binding Site BS01

Receptor Information
>1k79 Chain A (length=104) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
LDVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k79 Structural studies of Ets-1/Pax5 complex formation on DNA.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y386 R391 R394 Y397 K404 R409 Y410
Binding residue
(residue number reindexed from 1)		Y54 R59 R62 Y65 K72 R77 Y78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1k79, PDBe:1k79, PDBj:1k79
PDBsum1k79
PubMed11779502
UniProtP27577|ETS1_MOUSE Protein C-ets-1 (Gene Name=Ets1)

[Back to BioLiP]