Structure of PDB 1k6o Chain A Binding Site BS01

Receptor Information
>1k6o Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKP
NMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k6o Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex.
Resolution3.19 Å
Binding residue
(original residue number in PDB)		Y356 R361 R364 Y367 K374 F380
Binding residue
(residue number reindexed from 1)		Y54 R59 R62 Y65 K72 F78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1k6o, PDBe:1k6o, PDBj:1k6o
PDBsum1k6o
PubMed11846562
UniProtP28324|ELK4_HUMAN ETS domain-containing protein Elk-4 (Gene Name=ELK4)

[Back to BioLiP]