Structure of PDB 1k5r Chain A Binding Site BS01

Receptor Information
>1k5r Chain A (length=40) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FEIPDDVPLPAGWEMAKTSPGQRYFLNHIDQTTTWQDPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k5r Using flexible loop mimetics to extend phi-value analysis to secondary structure interactions.
ResolutionN/A
Binding residue
(original residue number in PDB)
T22 Y28 H32 T37 W39 K44
Binding residue
(residue number reindexed from 1)
T18 Y24 H28 T33 W35 K40
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1k5r, PDBe:1k5r, PDBj:1k5r
PDBsum1k5r
PubMed11687614
UniProtP46937|YAP1_HUMAN Transcriptional coactivator YAP1 (Gene Name=YAP1)

[Back to BioLiP]