Structure of PDB 1k3a Chain A Binding Site BS01

Receptor Information

>1k3a Chain A (length=291) Species: 9606 (Homo sapiens)

VPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNE
AASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDL
KSYLRSLRPEMPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAE
DFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDV
WSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLLELM
RMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK

Ligand information

>1k3a Chain B (length=8) Species: 9606 (Homo sapiens)

GEYVNIEF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1k3a Structure and autoregulation of the insulin-like growth factor 1 receptor kinase.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): D1105 R1109 G1140 K1141 G1142 L1143 L1144 P1145 W1148 S1153 L1154 D1156 G1157 N1188
• Binding residue (residue number reindexed from 1): D140 R144 G175 K176 G177 L178 L179 P180 W183 S188 L189 D191 G192 N223

Enzymatic activity

• Catalytic site (original residue number in PDB): D1105 R1109 N1110 D1123 E1132
• Catalytic site (residue number reindexed from 1): D140 R144 N145 D158 E167
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:1k3a, PDBe:1k3a, PDBj:1k3a
• PDBsum: 1k3a
• PubMed: 11694888
• UniProt: P08069|IGF1R_HUMAN Insulin-like growth factor 1 receptor (Gene Name=IGF1R)