Structure of PDB 1k2d Chain A Binding Site BS01

Receptor Information

>1k2d Chain A (length=182) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFA
QLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLL
GQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLS
YLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPE

Ligand information

>1k2d Chain P (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRGGASQYRPSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1k2d Structural snapshot of aberrant antigen presentation linked to autoimmunity: the immunodominant epitope of MBP complexed with I-Au
Resolution	2.2 Å
Binding residue (original residue number in PDB)	Y9 V11 F24 S53 F54 N62 T65 N69
Binding residue (residue number reindexed from 1)	Y9 V12 F25 S54 F55 N63 T66 N70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1k2d, PDBe:1k2d, PDBj:1k2d
PDBsum	1k2d
PubMed	12150894
UniProt	P14438\|HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) (Gene Name=H2-Aa)

[Back to BioLiP]