Structure of PDB 1k1g Chain A Binding Site BS01

Receptor Information
>1k1g Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSV
KEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETP
EDQNDLRKMQLRELARLNGTLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k1g Structural basis for recognition of the intron branch site RNA by splicing factor 1.
ResolutionN/A
Binding residue
(original residue number in PDB)		N151 V153 G154 L155 I157 G158 R160 L164 M176 I177 R178 G179 S182 V183 K184 R190 M195 L196 K241 L244 L247 T253 L254 R255
Binding residue
(residue number reindexed from 1)		N18 V20 G21 L22 I24 G25 R27 L31 M43 I44 R45 G46 S49 V50 K51 R57 M62 L63 K108 L111 L114 T120 L121 R122
Binding affinityPDBbind-CN: Kd=1uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1k1g, PDBe:1k1g, PDBj:1k1g
PDBsum1k1g
PubMed11691992
UniProtQ15637|SF01_HUMAN Splicing factor 1 (Gene Name=SF1)

[Back to BioLiP]