Structure of PDB 1k0t Chain A Binding Site BS01

Receptor Information

>1k0t Chain A (length=80) Species: 32049 (Picosynechococcus sp. PCC 7002)

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGC
KRCETACPTDFLSIRVYLGAETTRSMGLAY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 1k0t Chain A Residue 81

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1k0t Solution structure of the unbound, oxidized Photosystem I subunit PsaC, containing [4Fe-4S] clusters F(A) and F(B): a conformational change occurs upon binding to photosystem I.
• Resolution: N/A
• Binding residue (original residue number in PDB): T9 C10 I11 C13 T14 Q15 C16 V17 C57
• Binding residue (residue number reindexed from 1): T9 C10 I11 C13 T14 Q15 C16 V17 C57
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:0060090 molecular adaptor activity

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009522 photosystem I
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:1k0t, PDBe:1k0t, PDBj:1k0t
• PDBsum: 1k0t
• PubMed: 11941504
• UniProt: P31087|PSAC_PICP2 Photosystem I iron-sulfur center (Gene Name=psaC)