Structure of PDB 1jyr Chain A Binding Site BS01

Receptor Information
>1jyr Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDV
QHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jyr Crystal structures of the SH2 domain of Grb2: highlight on the binding of a new high-affinity inhibitor.
Resolution1.55 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 S90 S96 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)
R12 R31 S33 S35 S41 H52 F53 K54 L65 W66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1jyr, PDBe:1jyr, PDBj:1jyr
PDBsum1jyr
PubMed11827484
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]