Structure of PDB 1jxq Chain A Binding Site BS01

Receptor Information
>1jxq Chain A (length=242) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCE
KLRRRFSSLHFMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHG
CQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACG
GEQKDHGFEVLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQW
AHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jxq Dimer formation drives the activation of the cell death protease caspase 9.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R179 H237 C285 K290 S339 W340 R341 I382
Binding residue
(residue number reindexed from 1)		R42 H99 C149 K154 S179 W180 R181 I222
Enzymatic activity
Catalytic site (original residue number in PDB) R177 T178 H237 G238 C285 G286
Catalytic site (residue number reindexed from 1) R40 T41 H99 G100 C149 G150
Enzyme Commision number 3.4.22.62: caspase-9.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jxq, PDBe:1jxq, PDBj:1jxq
PDBsum1jxq
PubMed11734640
UniProtP55211|CASP9_HUMAN Caspase-9 (Gene Name=CASP9)

[Back to BioLiP]