Structure of PDB 1jxp Chain A Binding Site BS01

Receptor Information
>1jxp Chain A (length=177) Species: 11105 (Hepatitis C virus (isolate BK)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVC
WTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSS
DLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVG
IFRAAVCTRGVAKAVDFVPVESMETTM
Ligand information
>1jxp Chain C (length=12) Species: 11105 (Hepatitis C virus (isolate BK)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSVVIVGRIILS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jxp Complex of NS3 protease and NS4A peptide of BK strain hepatitis C virus: a 2.2 A resolution structure in a hexagonal crystal form.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
I3 T4 A5 Y6 S7 Q8 T10 R11 T19 S20 E30 E32 V33 Q34 V35 V36 S37 K62 T63 L64 A65 V107
Binding residue
(residue number reindexed from 1)
I1 T2 A3 Y4 S5 Q6 T8 R9 T17 S18 E28 E30 V31 Q32 V33 V34 S35 K60 T61 L62 A63 V105
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H55 D79 G135 S137
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.21.98: hepacivirin.
3.4.22.-
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1jxp, PDBe:1jxp, PDBj:1jxp
PDBsum1jxp
PubMed9568891
UniProtP26663|POLG_HCVBK Genome polyprotein

[Back to BioLiP]