Structure of PDB 1jxp Chain A Binding Site BS01

Receptor Information

>1jxp Chain A (length=177) Species: 11105 (Hepatitis C virus (isolate BK))

ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVC
WTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSS
DLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVG
IFRAAVCTRGVAKAVDFVPVESMETTM

Ligand information

>1jxp Chain C (length=12) Species: 11105 (Hepatitis C virus (isolate BK))

GSVVIVGRIILS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1jxp Complex of NS3 protease and NS4A peptide of BK strain hepatitis C virus: a 2.2 A resolution structure in a hexagonal crystal form.
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): I3 T4 A5 Y6 S7 Q8 T10 R11 T19 S20 E30 E32 V33 Q34 V35 V36 S37 K62 T63 L64 A65 V107
• Binding residue (residue number reindexed from 1): I1 T2 A3 Y4 S5 Q6 T8 R9 T17 S18 E28 E30 V31 Q32 V33 V34 S35 K60 T61 L62 A63 V105

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H55 D79 G135 S137
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:1jxp, PDBe:1jxp, PDBj:1jxp
• PDBsum: 1jxp
• PubMed: 9568891
• UniProt: P26663|POLG_HCVBK Genome polyprotein