Structure of PDB 1jw6 Chain A Binding Site BS01

Receptor Information

>1jw6 Chain A (length=237) Species: 3823 (Canavalia ensiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGT
DGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIK
SPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN

Ligand information

>1jw6 Chain B (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MYWYPY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jw6 Crystal structure of the complex of concanavalin A and hexapeptide.
Resolution	1.93 Å
Binding residue (original residue number in PDB)	T11 P13 T15 G18 P20 S21 Y22 P23 H205 P206
Binding residue (residue number reindexed from 1)	T11 P13 T15 G18 P20 S21 Y22 P23 H205 P206

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030246	carbohydrate binding

View graph for
Molecular Function

External links

PDB	RCSB:1jw6, PDBe:1jw6, PDBj:1jw6
PDBsum	1jw6
PubMed	11732694
UniProt	P02866\|CONA_CANEN Concanavalin-A

[Back to BioLiP]