Structure of PDB 1juq Chain A Binding Site BS01

Receptor Information

>1juq Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQS
PQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRV
SEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTL
I

Ligand information

>1juq Chain E (length=5) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DDHLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1juq Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	F87 R88 N91 I94 K95 Y101 K130 M137
Binding residue (residue number reindexed from 1)	F81 R82 N85 I88 K89 Y95 K124 M131

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0031267	small GTPase binding
GO:0035091	phosphatidylinositol binding
GO:0043130	ubiquitin binding

	Biological Process
GO:0006886	intracellular protein transport

	Cellular Component
GO:0005802	trans-Golgi network

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1juq, PDBe:1juq, PDBj:1juq
PDBsum	1juq
PubMed	11859375
UniProt	Q9NZ52\|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 (Gene Name=GGA3)

[Back to BioLiP]