Structure of PDB 1jui Chain A Binding Site BS01

Receptor Information

>1jui Chain A (length=237) Species: 3823 (Canavalia ensiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGT
DGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIK
SPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN

Ligand information

>1jui Chain P (length=10) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MYWYPYASGS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jui Plasticity in protein-peptide recognition: crystal structures of two different peptides bound to concanavalin A.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	N44 K46 S201 P202
Binding residue (residue number reindexed from 1)	N44 K46 S201 P202

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005537	D-mannose binding
GO:0030246	carbohydrate binding
GO:0046872	metal ion binding
GO:0090729	toxin activity

	Biological Process
GO:0035821	modulation of process of another organism

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jui, PDBe:1jui, PDBj:1jui
PDBsum	1jui
PubMed	11371463
UniProt	P55915\|CONA_CANBR Concanavalin-Br

[Back to BioLiP]