Structure of PDB 1ju5 Chain A Binding Site BS01

Receptor Information
>1ju5 Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYI
INSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDT
TTLIEPVSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ju5 Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide
ResolutionN/A
Binding residue
(original residue number in PDB)		R20 R38 S40 S41 T42 Y60 I61 L109
Binding residue
(residue number reindexed from 1)		R9 R27 S29 S30 T31 Y49 I50 L98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ju5, PDBe:1ju5, PDBj:1ju5
PDBsum1ju5
PubMed12384576
UniProtP46108|CRK_HUMAN Adapter molecule crk (Gene Name=CRK)

[Back to BioLiP]