Structure of PDB 1jt0 Chain A Binding Site BS01

Receptor Information

>1jt0 Chain A (length=188) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFL
EILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIE
FYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKI
AANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH

Ligand information

>1jt0 Chain E (length=28) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cttatagaccgatcgatcggtctataag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jt0 Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	L3 S34 S35 G37 N38 Y41 H42
Binding residue (residue number reindexed from 1)	L2 S33 S34 G36 N37 Y40 H41
Binding affinity	PDBbind-CN: Kd=49nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0045892	negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jt0, PDBe:1jt0, PDBj:1jt0
PDBsum	1jt0
PubMed	11867549
UniProt	P0A0N4\|QACR_STAAU HTH-type transcriptional regulator QacR (Gene Name=qacR)

[Back to BioLiP]