Structure of PDB 1jpl Chain A Binding Site BS01

Receptor Information
>1jpl Chain A (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIA
VRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKV
VSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQS
DPPIPVDRTLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jpl Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K86 F87 R88 N91 I94 K95 S98 Y101 K130 M137 Q141
Binding residue
(residue number reindexed from 1)		K90 F91 R92 N95 I98 K99 S102 Y105 K134 M141 Q145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
GO:0035091 phosphatidylinositol binding
GO:0043130 ubiquitin binding
Biological Process
GO:0006886 intracellular protein transport
Cellular Component
GO:0005802 trans-Golgi network

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jpl, PDBe:1jpl, PDBj:1jpl
PDBsum1jpl
PubMed11859375
UniProtQ9NZ52|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 (Gene Name=GGA3)

[Back to BioLiP]