Structure of PDB 1jp5 Chain A Binding Site BS01

Receptor Information
>1jp5 Chain A (length=232) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DILMTQTPLYLPVSLGDQASISCRSSQTIVHNNGNTYLEWYLQKPGQSPQ
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFP
PTFGGGTKLEIKEVQLQQSGPELKKPGETVKISCKATNYAFTDYSMHWVK
QAPGGDLKYVGWINTETDEPTFADDFKGRFAFSLDTSTSTAFLQINNLKN
EDTATYFCVRDRHDYGEIFTYWGQGTTVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jp5 Structural basis of HIV-1 and HIV-2 protease inhibition by a monoclonal antibody.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
H31 Y37 G96 F99 T157 D158 Y159 S160 H162 Y174 W177 N179 T180 D226 H228 D229
Binding residue
(residue number reindexed from 1)
H31 Y37 G96 F99 T142 D143 Y144 S145 H147 Y159 W162 N164 T165 D211 H213 D214
External links