Structure of PDB 1jmq Chain A Binding Site BS01

Receptor Information

>1jmq Chain A (length=46) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FEIPDDVPLPAGWEMAKTSSGQRYFKNHIDQTTTWQDPRKAMLSQM

Ligand information

>1jmq Chain P (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GTPPPPYTVG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jmq Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
Resolution	N/A
Binding residue (original residue number in PDB)	Y28 N31 H32 Q35 T36 T37 W39
Binding residue (residue number reindexed from 1)	Y24 N27 H28 Q31 T32 T33 W35

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1jmq, PDBe:1jmq, PDBj:1jmq
PDBsum	1jmq
PubMed	11743730
UniProt	P46937\|YAP1_HUMAN Transcriptional coactivator YAP1 (Gene Name=YAP1)

[Back to BioLiP]