Structure of PDB 1jmc Chain A Binding Site BS01

Receptor Information
>1jmc Chain A (length=238) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGE
IRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNN
ETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKI
TVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGAR
VSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jmc Structure of the single-stranded-DNA-binding domain of replication protein A bound to DNA.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R210 W212 R216 L221 R234 F238 N266 F269 E277 I332 V334 R339 K343 W361 R382 F386 S392 S395
Binding residue
(residue number reindexed from 1)		R28 W30 R34 L39 R52 F56 N84 F87 E95 I150 V152 R157 K161 W179 R200 F204 S210 S213
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jmc, PDBe:1jmc, PDBj:1jmc
PDBsum1jmc
PubMed8990123
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]