Structure of PDB 1jl4 Chain A Binding Site BS01

Receptor Information

>1jl4 Chain A (length=178) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HVGSYGITVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFAQLRR
FEPQGGLQNIATGKHNLEILTKRSNSTPATNEAPQATVFPKSPVLLGQPN
TLICFVDNIFPPVINITWLRNSKSVTDGVYETSFFVNRDYSFHKLSYLTF
IPSDDDIYDCKVEHWGLEEPVLKHWEPE

Ligand information

>1jl4 Chain C (length=16) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GNSHRGAIEWEGIESG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jl4 Crystal structure of the human CD4 N-terminal two-domain fragment complexed to a class II MHC molecule.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	Y9 T11 F24 L51 R52 R53 F54 N62 T65 G66 N69
Binding residue (residue number reindexed from 1)	Y5 T8 F21 L48 R49 R50 F51 N59 T62 G63 N66

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jl4, PDBe:1jl4, PDBj:1jl4
PDBsum	1jl4
PubMed	11535811
UniProt	P01910\|HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]