Structure of PDB 1jk8 Chain A Binding Site BS01

Receptor Information
>1jk8 Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRR
FRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLG
QPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISY
LTFLPSDDEIYDCKVEHWGLDEPLLKHWEPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jk8 Structure of a human insulin peptide-HLA-DQ8 complex and susceptibility to type 1 diabetes.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y9 Y22 W43 R52 R53 F58 N62 V65 L66 H68 N69 R76
Binding residue
(residue number reindexed from 1)		Y8 Y22 W43 R52 R53 F58 N62 V65 L66 H68 N69 R76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jk8, PDBe:1jk8, PDBj:1jk8
PDBsum1jk8
PubMed11376336
UniProtP01909|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]